PFKFB4 Rabbit Polyclonal Antibody

CAT#: TA342218

Rabbit polyclonal Anti-PFKFB4 Antibody

Product Images

WB Suggested Anti-PFKFB4 Antibody ; Positive Control: Lane 1: 40ug HEK293 lysate Lane 2: 40ug H1299 lysate; Primary Antibody Dilution : 1:1000; Secondary Antibody : Goat anti-rabbit-HRP; Secondry Antibody Dilution : 1:5000;

• 

  WB Suggested Anti-PFKFB4 Antibody ; Positive Control: Lane 1: 10ug human primary tumor lysate; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution : 1:5000;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PFKFB4 antibody: synthetic peptide directed towards the N terminal of human PFKFB4. Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
• Database Link:
  NP_004558
  Entrez Gene 5210 Human
  UniProt ID Q16877
• Background: Synthesis and degradation of fructose 2,6-bisphosphate.
• Synonyms: 6-biphosphatase-4; 6-biphosphatase 4; 6-phosphofructo-2-kinase; bifunctional enzyme with kinase and biphosphatase activities; fructose-2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism