PFKFB4 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PFKFB4 |
PFKFB4 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PFKFB4 |
Rabbit polyclonal Anti-PFKFB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFKFB4 antibody: synthetic peptide directed towards the N terminal of human PFKFB4. Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR |
Carrier-free (BSA/glycerol-free) PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Pfkfb4 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
PFKFB4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PFKFB4 |
Anti-PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
PFKFB4 mouse monoclonal antibody, clone 1C8, Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PFKFB4 mouse monoclonal antibody, clone 1C8, HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-PFKFB4 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |