Primary Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-Rab3 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab3a produced in E. coli.

RAB3A (202-217) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Monkey
Immunogen RAB3A antibody was raised against a 16 residue synthetic peptide based on the human Rab3A (residues 202-217) (1) with the cysteine (C) residue added and the peptide coupled to KLH.

RAB3A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human RAB3A

Rabbit Anti-Rab 3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH

Rabbit Polyclonal Anti-RAB3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB3A antibody: synthetic peptide directed towards the C terminal of human RAB3A. Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

RAB3A rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAB3A

RAB3A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAB3A

RAB3A Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB3A (NP_002857.1).
Modifications Unmodified