Primary Antibodies

View as table Download

TAS1R2 / T1R2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TAS1R2 / T1R2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human TAS1R2. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Orangutan, Gibbon (95%); Baboon, Monkey (85%).

TAS1R2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 698-726 amino acids from the C-terminal region of human TAS1R2

Goat Polyclonal Antibody against TAS1R2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CSKRCQSGQKKKP, from the internal region of the protein sequence according to NP_689418.2.

Rabbit Polyclonal Anti-TAS1R2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R2 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R2. Synthetic peptide located within the following region: ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTE

TAS1R2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TAS1R2 (NP_689418.2).