Primary Antibodies

Jump to Filters
View as table Download
ALG10 Rabbit Polyclonal Antibody
TA331308

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALG10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALG10 antibody is: synthetic peptide directed towards the middle region of Human ALG10. Synthetic peptide located within the following region: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM