ALG10 Rabbit Polyclonal Antibody

CAT#: TA331308

Rabbit Polyclonal Anti-ALG10 Antibody

Product Images

WB Suggested Anti-ALG10 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ALG10 antibody is: synthetic peptide directed towards the middle region of Human ALG10. Synthetic peptide located within the following region: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: ALG10, alpha-1,2-glucosyltransferase
• Database Link:
  NP_116223
  Entrez Gene 84920 Human
  UniProt ID Q5BKT4
• Background: This gene encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the terminal glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9GlcNAc(2)-PP-Dol. The rat protein homolog was shown to specifically modulate the gating function of the rat neuronal ether-a-go-go (EAG) potassium ion channel.
• Synonyms: ALG10A; DIE2; KCR1
• Note: Human: 100%; Rabbit: 90%; Dog: 87%; Pig: 87%; Rat: 87%; Horse: 87%; Bovine: 87%; Guinea pig: 87%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis