Antibodies

Jump to Filters
View as table Download
ALG10 (N-term) Rabbit Polyclonal Antibody
AP50145PU-N

USD 450.00

2 Weeks

ALG10 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 17~43 amino acids from the N-terminal region of human ALG10
ALG10 Rabbit Polyclonal Antibody
TA331308

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALG10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALG10 antibody is: synthetic peptide directed towards the middle region of Human ALG10. Synthetic peptide located within the following region: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM