HRH3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRH3 |
HRH3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRH3 |
Rabbit Polyclonal Anti-H3 Histamine Receptor
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RTRLRLDGGREAGPE, corresponding to amino acids 228-242 of rat H3 Histamine Receptor. 3rd intracellular loop. |
Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1) |
Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 299 and 389 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1) |
Goat Anti-histamine H3 receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SVTRAVSYRAQQGDT, from the internal region of the protein sequence according to NP_009163.2. |
Histamine 3 Receptor / HRH3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HRH3 / Histamine 3 Receptor antibody was raised against synthetic 16 amino acid peptide from 2nd cytoplasmic domain of human HRH3 / Histamine H3 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Guinea pig (100%); Panda, Bat, Dog (94%); Opossum (81%). |
Rabbit Polyclonal Anti-HRH3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HRH3 antibody is: synthetic peptide directed towards the C-terminal region of Human HRH3. Synthetic peptide located within the following region: LGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMV |
Rabbit Polyclonal Anti-HRH3 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Hrh3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hrh3. Synthetic peptide located within the following region: VFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAI |
Rabbit Polyclonal Anti-HRH3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HRH3 |
HRH3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HRH3 (NP_009163.2). |
Modifications | Unmodified |
HRH3 Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |