USD 315.00
2 Weeks
Creatine kinase M type (CKM) mouse monoclonal antibody, clone A12E3-15-12, Purified
Applications | ELISA |
Reactivities | Human |
USD 315.00
2 Weeks
Creatine kinase M type (CKM) mouse monoclonal antibody, clone A12E3-15-12, Purified
Applications | ELISA |
Reactivities | Human |
Goat Polyclonal Anti-creatine kinase M-type (aa258-270) Antibody
Applications | WB |
Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-creatine kinase M-type (aa258-270) Antibody: Peptide with sequence C-QKIEEIFKKAGHP, from the internal region of the protein sequence according to NP_001815.2. |
Rabbit polyclonal anti-CKM / M-CK antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK. |
Creatine kinase M type (CKM) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to the N-terminus of Human Creatine Kinase M. |
Rabbit Polyclonal Anti-CKM Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL |
Rabbit Polyclonal Anti-CKM Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI |
USD 360.00
2 Weeks
Creatine kinase M type (CKM) mouse monoclonal antibody, clone 027-17186, Purified
Applications | ELISA |
Reactivities | Human |
Creatine kinase M type (CKM) goat polyclonal antibody, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Immunogen | Purified CK-MM from human skeletal muscle |
Anti-CKM Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 14-26 amino acids of Human creatine kinase, muscle |