Goat Anti-CLCA1 (aa872-884) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PETPSPDETSAPC, from the internal region of the protein sequence according to NP_001276.2. |
Goat Anti-CLCA1 (aa872-884) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PETPSPDETSAPC, from the internal region of the protein sequence according to NP_001276.2. |
CLCA1 mouse monoclonal antibody, clone 1C4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CLCA1 (872-884) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human CLCA1 |
Rabbit Polyclonal antibody to CLCA1 (chloride channel accessory 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 542 and 633 of CLCA1 (Uniprot ID#A8K7I4) |
Rabbit Polyclonal Anti-CLCA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLCA2 antibody: synthetic peptide directed towards the C terminal of human CLCA2. Synthetic peptide located within the following region: RYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGNIQM |
Carrier-free (BSA/glycerol-free) CLCA1 mouse monoclonal antibody,clone OTI8E7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CLCA4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 306-476 amino acids of Human Calcium-activated chloride channel regulator 4 |
Anti-CLCA4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 306-476 amino acids of human Calcium-activated chloride channel regulator 4 |
CLCA1 mouse monoclonal antibody,clone OTI8E7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CLCA1 mouse monoclonal antibody,clone OTI8E7, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CLCA1 mouse monoclonal antibody,clone OTI8E7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CLCA1 mouse monoclonal antibody,clone OTI8E7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |