Primary Antibodies

Jump to Filters
View as table Download
CLCA1 Goat Polyclonal Antibody
TA305861

USD 375.00

In Stock

Goat Anti-CLCA1 (aa872-884) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PETPSPDETSAPC, from the internal region of the protein sequence according to NP_001276.2.
CLCA1 Mouse Monoclonal Antibody [Clone ID: 1C4]
AM31924PU-N

USD 480.00

2 Weeks

CLCA1 mouse monoclonal antibody, clone 1C4, Purified

Applications ELISA, IHC, WB
Reactivities Human
CLCA1 (872-884) Goat Polyclonal Antibody
AP23101PU-N

USD 440.00

2 Weeks

CLCA1 (872-884) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CLCA1
CLCA1 Rabbit Polyclonal Antibody
TA307979

USD 415.00

5 Days

Rabbit Polyclonal antibody to CLCA1 (chloride channel accessory 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 542 and 633 of CLCA1 (Uniprot ID#A8K7I4)
CLCA2 Rabbit Polyclonal Antibody
TA338561

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLCA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLCA2 antibody: synthetic peptide directed towards the C terminal of human CLCA2. Synthetic peptide located within the following region: RYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGNIQM
CLCA1 Mouse Monoclonal Antibody [Clone ID: OTI8E7]
CF809864

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLCA1 mouse monoclonal antibody,clone OTI8E7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
CLCA4 Rabbit Polyclonal Antibody
TA321811

USD 345.00

4 Weeks

Anti-CLCA4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 306-476 amino acids of Human Calcium-activated chloride channel regulator 4
CLCA4 Rabbit Polyclonal Antibody
TA321812

USD 345.00

4 Weeks

Anti-CLCA4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 306-476 amino acids of human Calcium-activated chloride channel regulator 4
CLCA1 Mouse Monoclonal Antibody [Clone ID: OTI8E7]
TA809864

USD 379.00

In Stock

CLCA1 mouse monoclonal antibody,clone OTI8E7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
CLCA1 Mouse Monoclonal Antibody [Clone ID: OTI8E7]
TA809864S

USD 159.00

2 Days

CLCA1 mouse monoclonal antibody,clone OTI8E7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated