Mouse Monoclonal anti-trpc4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal anti-trpc4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Anti-TRPC4 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHAKEEDSSIDYD, from the internal region (near C-Terminus) of the protein sequence according to NP_057263.1. |
TRPC4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 811-840 amino acids from the C-terminal region of human TRPC4 |
Rabbit Polyclonal Anti-TRPC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC4 antibody: synthetic peptide directed towards the middle region of human TRPC4. Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |