Primary Antibodies

View as table Download

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit anti-AOC3 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AOC3

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

Goat Anti-AOC3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEDPSFYSADSIY, from the internal region (near the C Terminus) of the protein sequence according to NP_003725.1.

Rabbit polyclonal AOC3 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3.

Rabbit Polyclonal Aldh3A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2.

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

AOC2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog
Immunogen Synthetic peptide directed towards the middle region of human AOC2

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications WB
Reactivities Human, Monkey, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)

Applications WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2

AOC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AOC2

AOC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AOC2

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications WB
Reactivities Human, Monkey, Rat
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications WB
Reactivities Human, Monkey, Rat
Conjugation HRP

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation HRP

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated

Applications WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated

Applications WB
Reactivities Human, Monkey, Rat, Dog
Conjugation HRP