Metabotropic Glutamate Receptor 7 (GRM7) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 860-918 of Human mGluR-7. |
Metabotropic Glutamate Receptor 7 (GRM7) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 860-918 of Human mGluR-7. |
Rabbit polyclonal anti-GRM7 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GRM7. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-GluR7 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GluR7. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-mGluR7 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-mGluR7 Antibody: A synthesized peptide derived from human mGluR7 |
Goat Anti-GRM7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence NCKLTISGSKKEDT, from the internal region of the protein sequence according to NP_000835.1; NP_870989.1. |
GRM7 / MGLUR7 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Bovine, Human |
Conjugation | Unconjugated |
Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Elephant, Bovine (100%); Chimpanzee, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Dog, Horse (95%); Gibbon, Panda, Rabbit, Opossum (89%); Chicken, Xenopus (84%). |
Rabbit Polyclonal Anti-GRM7 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 15 amino acid peptide from 2nd extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Dolphin, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Opossum, Turkey, Chicken (93%). |
Rabbit Polyclonal Anti-GRM7 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Panda, Bovine, Dog, Horse (100%); Rabbit (95%); Opossum, Turkey, Chicken (80%). |
Rabbit Polyclonal Anti-GRM7 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Opossum, Turkey, Chicken (100%). |
Rabbit Polyclonal Anti-GRM7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRM7 antibody: synthetic peptide directed towards the C terminal of human GRM7. Synthetic peptide located within the following region: HPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS |