Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-A4GALT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE

Rabbit Polyclonal Anti-A4GALT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

Rabbit Polyclonal Anti-A4GALT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human A4GALT

A4GALT rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human A4GALT

A4GALT rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human A4GALT

A4GALT rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human A4GALT

A4GALT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 244-353 of human A4GALT (NP_059132.1).
Modifications Unmodified