A4GALT Rabbit Polyclonal Antibody

CAT#: TA342030

Rabbit Polyclonal Anti-A4GALT Antibody

Product Images

WB Suggested Anti-A4GALT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: alpha 1,4-galactosyltransferase
• Database Link:
  NP_059132
  Entrez Gene 53947 Human
  UniProt ID Q9NPC4
• Background: The protein encoded byThis gene catalyzesThe transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified asThe P(k) antigen ofThe P blood group system.The encoded protein, which is a type II membrane protein found inThe Golgi, is also required forThe synthesis ofThe bacterial verotoxins receptor. [provided by RefSeq, Jul 2008]
• Synonyms: A4GALT1; A14GALT; Gb3S; P(k); P1; P1PK; PK
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - globo series, Metabolic pathways