A4GALT Rabbit Polyclonal Antibody
Other products for "A4GALT"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | alpha 1,4-galactosyltransferase |
Database Link | |
Background | The protein encoded byThis gene catalyzesThe transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified asThe P(k) antigen ofThe P blood group system.The encoded protein, which is a type II membrane protein found inThe Golgi, is also required forThe synthesis ofThe bacterial verotoxins receptor. [provided by RefSeq, Jul 2008] |
Synonyms | A4GALT1; A14GALT; Gb3S; P(k); P1; P1PK; PK |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Glycosphingolipid biosynthesis - globo series, Metabolic pathways |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.