Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-Chmp2b Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Chmp2b antibody is: synthetic peptide directed towards the N-terminal region of Rat Chmp2b. Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK |
CHMP2B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHMP2B |
CHMP2B Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-213 of human CHMP2B (NP_054762.2). |
| Modifications | Unmodified |