Primary Antibodies

View as table Download

NPBWR1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NPBWR1

NPBWR1 / GPR7 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen NPBWR1 / GPR7 antibody was raised against synthetic 17 amino acid peptide from 2nd cytoplasmic domain of human NPBWR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Bovine, Horse, Rabbit (94%); Marmoset, Mouse, Rat (88%); Elephant (82%).

NPBWR1 / GPR7 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen NPBWR1 / GPR7 antibody was raised against synthetic 14 amino acid peptide from C-terminus of human NPBWR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (86%).

NPBWR1 / GPR7 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen NPBWR1 / GPR7 antibody was raised against synthetic 19 amino acid peptide from 2nd extracellular domain of human NPBWR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Panda (100%); Marmoset, Mouse, Rat, Bovine, Horse (95%); Rabbit (84%).

Rabbit Polyclonal Anti-NPBWR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPBWR1 antibody is: synthetic peptide directed towards the N-terminal region of Human NPBWR1. Synthetic peptide located within the following region: FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN

NPBWR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human NPBWR1 (NP_005276.2).
Modifications Unmodified