Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human, Rat
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the N terminal of human PAX4. Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK

PAX4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human PAX4 (NP_006184.2).
Modifications Unmodified