Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KIRREL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KIRREL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KIRREL2.

SESN2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SESN2

Rabbit Polyclonal Anti-SESN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SESN2 antibody: synthetic peptide directed towards the N terminal of human SESN2. Synthetic peptide located within the following region: LKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESL

Rabbit Polyclonal Anti-SESN2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SESN2

SESN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SESN2

SESN2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-480 of human SESN2 (NP_113647.1).
Modifications Unmodified

SESN2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-480 of human SESN2 (NP_113647.1).
Modifications Unmodified