SESN2 Rabbit Polyclonal Antibody

CAT#: TA343006

Rabbit Polyclonal Anti-SESN2 Antibody

Product Images

WB Suggested Anti-SESN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SESN2 antibody: synthetic peptide directed towards the N terminal of human SESN2. Synthetic peptide located within the following region: LKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: sestrin 2
• Database Link:
  NP_113647
  Entrez Gene 83667 Human
  UniProt ID P58004
• Background: This gene encodes a member of the sestrin family of PA26-related proteins. The encoded protein may function in the regulation of cell growth and survival. This protein may be involved in cellular response to different stress conditions.
• Synonyms: HI95; SES2; SEST2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 88%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Pathways: p53 signaling pathway