Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-USP38 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human USP38. |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-USP38 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP38 antibody: synthetic peptide directed towards the middle region of human USP38. Synthetic peptide located within the following region: LVNKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEK |
USP38 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human USP38 |