USP38 Rabbit Polyclonal Antibody

CAT#: TA342575

Rabbit Polyclonal Anti-USP38 Antibody

Product Images

WB Suggested Anti-USP38 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP38 antibody: synthetic peptide directed towards the middle region of human USP38. Synthetic peptide located within the following region: LVNKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 116 kDa
• Gene Name: ubiquitin specific peptidase 38
• Database Link:
  NP_115946
  Entrez Gene 84640 Human
  UniProt ID Q8NB14
• Background: The function of USP38 remians unknown.
• Synonyms: HP43.8KD
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Rat: 85%; Mouse: 83%

Reference Data

• Protein Families: Druggable Genome, Protease