Primary Antibodies

Jump to Filters
View as table Download
NEGR1 Rabbit Polyclonal Antibody
TA316275

USD 345.00

4 Weeks

Rabbit polyclonal anti-NEGR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NEGR1.
NEGR1 Rabbit Polyclonal Antibody
TA331416

USD 375.00

5 Days

Rabbit polyclonal Anti-NEGR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEGR1 antibody: synthetic peptide directed towards the N terminal of human NEGR1. Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
NEGR1 Mouse Monoclonal Antibody [Clone ID: OTI3G8]
CF810275

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NEGR1 mouse monoclonal antibody,clone OTI3G8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NEGR1 Mouse Monoclonal Antibody [Clone ID: OTI3G8]
TA810275

USD 379.00

In Stock

NEGR1 mouse monoclonal antibody,clone OTI3G8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NEGR1 Mouse Monoclonal Antibody [Clone ID: OTI3G8]
TA810275S

USD 159.00

2 Days

NEGR1 mouse monoclonal antibody,clone OTI3G8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated