Rabbit Polyclonal Ipaf Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Ipaf antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human Ipaf. |
Rabbit Polyclonal Ipaf Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Ipaf antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human Ipaf. |
Rabbit Polyclonal Anti-NLRC4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLRC4 antibody: synthetic peptide directed towards the C terminal of human NLRC4. Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV |
Rabbit Polyclonal CARD12 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human CARD12 protein (between residues 600-700) [UniProt Q9NPP4] |
Rabbit Polyclonal CARD12 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human CARD12 protein (between residues 950-1015) [UniProt Q9NPP4] |
Rabbit Polyclonal CARD12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | N terminus (MNFIKDNSRALIQRMGM) of the A and B isoforms of the human CLAN protein. |