Rabbit Polyclonal NPFFR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | N terminal sequence MNEKWDTNSSENWHPI and the C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein. |
Rabbit Polyclonal NPFFR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | N terminal sequence MNEKWDTNSSENWHPI and the C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein. |
Rabbit Polyclonal Anti-NPFFR2 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | NPFF2 / NPFFR2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human NPFFR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (94%); Marmoset (89%). |
Rabbit Polyclonal Anti-NPFFR2 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | NPFF2 / NPFFR2 antibody was raised against synthetic 18 amino acid peptide from 3rd extracellular domain of human NPFFR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Horse (100%); Monkey, Elephant, Rabbit, Pig (94%); Dog, Bovine (89%); Mouse, Rat, Panda, Bat (83%). |
Rabbit Polyclonal Anti-NPFFR2 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | NPFF2 / NPFFR2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human NPFFR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (95%). |
Rabbit Polyclonal Anti-NPFFR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NPFFR2 antibody: synthetic peptide directed towards the C terminal of human NPFFR2. Synthetic peptide located within the following region: KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT |
Rabbit Polyclonal Anti-NPFFR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NPFFR2 antibody: synthetic peptide directed towards the middle region of human NPFFR2. Synthetic peptide located within the following region: VPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA |