Primary Antibodies

View as table Download

Rabbit polyclonal Anti-DHX16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX16 antibody: synthetic peptide directed towards the N terminal of human DHX16. Synthetic peptide located within the following region: KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV

DHX16 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated