DHX16 Rabbit Polyclonal Antibody

CAT#: TA331470

Rabbit polyclonal Anti-DHX16 Antibody

Product Images

WB Suggested Anti-DHX16 Antibody Titration: 0.125ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysateDHX16 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHX16 antibody: synthetic peptide directed towards the N terminal of human DHX16. Synthetic peptide located within the following region: KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 115 kDa
• Gene Name: DEAH-box helicase 16
• Database Link:
  NP_003578
  Entrez Gene 8449 Human
  UniProt ID O60231
• Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.
• Synonyms: DBP2; DDX16; PRO2014; Prp2; PRP8; PRPF2
• Note: Human: 100%; Goat: 86%; Horse: 86%; Bovine: 86%; Pig: 85%; Rat: 79%; Mouse: 79%; Rabbit: 77%

Reference Data

• Protein Pathways: Spliceosome