DHX16 Rabbit Polyclonal Antibody

CAT#: TA331470

Rabbit polyclonal Anti-DHX16 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DHX16"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DHX16 antibody: synthetic peptide directed towards the N terminal of human DHX16. Synthetic peptide located within the following region: KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 115 kDa
Gene Name DEAH-box helicase 16
Background DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.
Synonyms DBP2; DDX16; PRO2014; Prp2; PRP8; PRPF2
Note Human: 100%; Goat: 86%; Horse: 86%; Bovine: 86%; Pig: 85%; Rat: 79%; Mouse: 79%; Rabbit: 77%
Reference Data
Protein Pathways Spliceosome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.