Primary Antibodies

View as table Download

Rabbit polyclonal anti-SF3B14 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human SF3B14.

Rabbit Polyclonal Anti-SF3B14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the N terminal of human SF3B14. Synthetic peptide located within the following region: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV

Rabbit Polyclonal Anti-SF3B14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the middle region of human SF3B14. Synthetic peptide located within the following region: HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Carrier-free (BSA/glycerol-free) SF3B14 mouse monoclonal antibody,clone OTI8A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SF3B14 mouse monoclonal antibody,clone OTI8A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SF3B14 mouse monoclonal antibody,clone OTI8A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated