Goat Polyclonal Anti-CB1 (isoform a) Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CB1 (isoform a) Antibody: Peptide with sequence SNDIQYEDIKGDMAS-C, from the N Terminus of the protein sequence according to NP_057167.2. |
Goat Polyclonal Antibody against Cannabinoid Receptor 1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HTSEDGKVQVTRPDQ, from the internal region of the protein sequence according to NP_057167.2; NP_149421.1. |
Rabbit Polyclonal Anti-CNR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNR1 antibody: synthetic peptide directed towards the N terminal of human CNR1. Synthetic peptide located within the following region: ADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVL |
CNR1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CNR1 |
USD 380.00
4 Weeks
Phospho-Cannabinoid Receptor I (Ser316) Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
