Primary Antibodies

View as table Download

Goat Polyclonal Antibody against CBX1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSQKTAHETDKSE, from the internal region of the protein sequence according to NP_006798.1.

Rabbit Polyclonal Anti-CBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the N terminal of human CBX1. Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN

Rabbit Polyclonal Anti-CBX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CBX1 Antibody: synthetic peptide directed towards the middle region of human CBX1. Synthetic peptide located within the following region: PDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKP

Rabbit Polyclonal Anti-CBX1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX1

CBX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human CBX1 (NP_006798.1).
Modifications Unmodified

Recombinant Anti-CBX1 (Clone RAB-C145)

Applications ChIP, ELISA, IF
Reactivities Human
Conjugation His Tag

Recombinant Anti-CBX1 (Clone RAB-C145)

Applications ChIP, ELISA, IF
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques.