Primary Antibodies

View as table Download

Proteinase Activated Receptor 3 (F2RL2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 20-50 amino acids from the N-terminal region of human F2RL2

Rabbit polyclonal anti-F2RL2 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human F2RL2.

Rabbit Polyclonal Anti-F2RL2 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen F2RL2 / PAR3 antibody was raised against synthetic 19 amino acid peptide from internal region of human F2RL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset (100%); Monkey, Bovine, Panda (95%); Gibbon, Dog, Elephant, Pig (89%); Rat, Hamster (84%).

Rabbit Polyclonal Anti-F2RL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2RL2 antibody: synthetic peptide directed towards the C terminal of human F2RL2. Synthetic peptide located within the following region: HANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK

Rabbit Polyclonal Anti-F2RL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2RL2

F2RL2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PAR3