Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PRUNE Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRUNE antibody is: synthetic peptide directed towards the C-terminal region of Human PRUNE. Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS

PKM2 (PKM) (Isoform M1) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Immunogen Peptide sequence around aa. 399~403 derived from Human PKM1.

PKM2 (PKM) (Isoform M1) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Immunogen Peptide sequence around aa. 399~403 derived from Human PKM1.

Rabbit polyclonal anti-POLR2C antibody (C-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This POLR2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the C-terminal region of human POLR2C.

Anti-ADCY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1057-1070 amino acids of human adenylate cyclase 1 (brain)

Rabbit Polyclonal Anti-NPR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NPR2