PRUNE (PRUNE1) Rabbit Polyclonal Antibody

CAT#: TA344725

Rabbit Polyclonal Anti-PRUNE Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: PRUNE; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRUNE antibody is: synthetic peptide directed towards the C-terminal region of Human PRUNE. Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: prune exopolyphosphatase
• Database Link:
  NP_067045
  Entrez Gene 58497 Human
  UniProt ID Q86TP1
• Background: The function of this protein remains unknown.
• Synonyms: DRES-17; DRES17; HTCD37
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: Purine metabolism