Primary Antibodies

View as table Download

Rabbit anti-CDK9 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDK9

Rabbit polyclonal anti-Cdk9 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Multiple synthetic peptides corresponding to C-terminal and N-terminal domains of the protein coded by the human gene cdk9 (PITALRE).

Rabbit polyclonal CDK9 phospho T29 antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding T29 in the human CDK9 protein.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CDK9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK9 antibody: synthetic peptide directed towards the N terminal of human CDK9. Synthetic peptide located within the following region: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKV

Rabbit Polyclonal Anti-CDK9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK9 antibody: synthetic peptide directed towards the N terminal of human CDK9. Synthetic peptide located within the following region: PFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP

Rabbit anti Cdk9 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human CDK9 protein. This sequence is identical to human, rat and mouse.

Anti-CDK9 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-315 amino acids of human cyclin-dependent kinase 9

CDK9 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 153-372 of human CDK9 (NP_001252.1).
Modifications Unmodified

Phospho-CDK9-T186 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around T186 of human CDK9 (NP_001252.1).
Modifications Phospho T186