Primary Antibodies

View as table Download

Rabbit polyclonal anti-GPR37 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR37.

Rabbit polyclonal Pael-R (GPR37) Antibody (N-term)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This Pael-R (GPR37) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-126 amino acids from the N-terminal region of human Pael-R (GPR37).

Rabbit Polyclonal Anti-GPR37 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR37 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR37. Synthetic peptide located within the following region: KIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAY

Rabbit Polyclonal Anti-GPR37 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen PAEL Receptor / GPR37 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human GPR37. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (95%); Marmoset (90%); Rabbit (85%); Panda (80%).

GPR37 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GPR37

GPR37 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPR37

GPR37 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-180 of human GPR37 (NP_005293.1).