GPR37 Rabbit Polyclonal Antibody

CAT#: TA338153

Rabbit Polyclonal Anti-GPR37 Antibody

Product Images

WB Suggested Anti-GPR37 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR37 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR37. Synthetic peptide located within the following region: KIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: G protein-coupled receptor 37
• Database Link:
  NP_005293
  Entrez Gene 2861 Human
  UniProt ID O15354
• Background: GPR37 is an orphan receptor and may have a unique functional role in the central nervous system.
• Synonyms: EDNRBL; hET(B)R-LP; PAELR
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Parkinson's disease