Rabbit Polyclonal Anti-IVD Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IVD antibody is: synthetic peptide directed towards the N-terminal region of Human IVD. Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV |
Rabbit Polyclonal antibody to IVD (isovaleryl Coenzyme A dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 222 of IVD (Uniprot ID#P26440) |
IVD rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IVD |
IVD Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33-200 of human IVD (NP_002216.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
