IVD Rabbit Polyclonal Antibody

CAT#: TA344320

Rabbit Polyclonal Anti-IVD Antibody - N-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human isovaleryl Coenzyme A dehydrogenase (IVD), nuclear gene encoding mitochondrial protein
    • 20 ug

USD 823.00


Transient overexpression lysate of isovaleryl-CoA dehydrogenase (IVD), nuclear gene encoding mitochondrial protein, transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-IVD antibody is: synthetic peptide directed towards the N-terminal region of Human IVD. Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name isovaleryl-CoA dehydrogenase
Background Isovaleryl-CoA dehydrogenase (IVD) is a mitochondrial matrix enzyme that catalyzes the third step in leucine catabolism. The genetic deficiency of IVD results in an accumulation of isovaleric acid, which is toxic to the central nervous system and leads to isovaleric acidemia.
Synonyms ACAD2
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Mouse: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Valine, leucine and isoleucine degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.