KCNA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA3 |
KCNA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA3 |
Rabbit Polyclonal Anti-KV1.3 (extracellular)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human Kv1.3.Extracellular loop between domains S1 and S2. |
Rabbit Polyclonal Anti-KV1.3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus. |
KCNA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA3 |