KCNA3 Rabbit Polyclonal Antibody

CAT#: TA328686

Rabbit Polyclonal Anti-KV1.3

Product Images

Western blot analysis of rat brain membranes: 1. Anti-Kv1.3 antibody, (1:200) 2. Anti-Kv1.3 antibody, preincubated with the control peptide antigen.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB: 1:200-1:2000; IHC: 1:100-1:3000
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus.
• Formulation: Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
• Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to other Kv1 by affinity chromatography on immobilized Kv1.1-GST-fusion protein. The antibody was then affinity purified on immo
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Gene Name: potassium voltage-gated channel subfamily A member 3
• Database Link:
  NP_002223
  Entrez Gene 16491 MouseEntrez Gene 29731 RatEntrez Gene 3738 Human
  UniProt ID P22001
• Background: KV1.3 belongs to the Shaker family of voltage-dependent K+ channels. The channel is widely expressed in the brain, lung and osteoclasts and in several cell populations of hematopoietic origin. It is in these cells (particularly T lymphocytes) that KV1.3 function has centered a lot of attention. It was found that KV1.3 is the main channel.Responsible for maintaining the resting potential in quiescent cells and regulating the Ca2+ signaling that is indispensable for normal T lymphocyte activation.Based on the central role of Kv1.3 in regulating the initiation of an immune response, the channel has been recognized as a potential target for immunosuppressant drugs.
• Synonyms: HGK5; HLK3; HPCN3; HUKIII; KV1.3; MK3; PCN3

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane