NPBWR1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NPBWR1 |
NPBWR1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NPBWR1 |
NPBWR1 / GPR7 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | NPBWR1 / GPR7 antibody was raised against synthetic 17 amino acid peptide from 2nd cytoplasmic domain of human NPBWR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Bovine, Horse, Rabbit (94%); Marmoset, Mouse, Rat (88%); Elephant (82%). |
Rabbit Polyclonal Anti-NPBWR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NPBWR1 antibody is: synthetic peptide directed towards the N-terminal region of Human NPBWR1. Synthetic peptide located within the following region: FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN |
NPBWR1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human NPBWR1 (NP_005276.2). |
Modifications | Unmodified |