Rabbit anti-PDE1B Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDE1B |
Rabbit anti-PDE1B Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDE1B |
Anti-PDE1B Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 190-536 amino acids of human phosphodiesterase 1B, calmodulin-dependent |
Rabbit Polyclonal Anti-PDE1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDE1B antibody: synthetic peptide directed towards the middle region of human PDE1B. Synthetic peptide located within the following region: VKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNL |
PDE1B Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse PDE1B |