Primary Antibodies

Jump to Filters
View as table Download
RNASE11 Rabbit Polyclonal Antibody
TA340397

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNASE11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASE11 antibody: synthetic peptide directed towards the middle region of human RNASE11. Synthetic peptide located within the following region: GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL