Germany
Japan
United Kingdom
China
RNASE11 Rabbit Polyclonal Antibody
Product Images
Other products for "RNASE11"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RNASE11 antibody: synthetic peptide directed towards the middle region of human RNASE11. Synthetic peptide located within the following region: GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 22 kDa |
| Gene Name | ribonuclease A family member 11 (inactive) |
| Database Link | |
| Background | RNASE11 belongs to the pancreatic ribonuclease family. The function of RNASE11 remains unknown. |
| Synonyms | C14orf6; HEL-S-84p; RAJ1 |
| Note | Immunogen Sequence Homology: Human: 100%; Horse: 92%; Pig: 83%; Rabbit: 83%; Guinea pig: 83% |
| Reference Data | |
| Protein Families | Secreted Protein |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.