Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit anti-TNFSF13B Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFSF13B |
Rabbit Polyclonal Anti-TNFSF13B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP |
Rabbit Polyclonal BAFF/BLyS/TNFSF13B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This rabbit polyclonal antibody was developed against a C-terminal peptide corresponding to amino acids 254-269 of human TNFSF13B. |
Rabbit anti BAFF/BLys/Thank/Tall-1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TNFSF13B Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse TNFSF13B |
TNFSF13B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TNFSF13B |
Active filters
Target Symbol
- TNFSF13B
Clonalities
- Polyclonal
Conjugates
- Unconjugated