Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSG101 Antibody is: synthetic peptide directed towards the N-terminal region of Human TSG101. Synthetic peptide located within the following region: YKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYR

Rabbit polyclonal anti-TSG101 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TS101.

Rabbit Polyclonal Anti-TSG101 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TSG101 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS

TSG101 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse

TSG101 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human TS101

TSG101 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TSG101

TSG101 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TSG101

TSG101/VPS23 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TSG101/VPS23 (NP_006283.1).
Modifications Unmodified

TSG101 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TSG101. AA range:281-330

TSG101 Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human TSG101