Tsg101 Rabbit Polyclonal Antibody

CAT#: TA329920

Rabbit Polyclonal Anti-TSG101 Antibody

Product Images

Sample Type: mouse fibroblast lusate (10 ug); Primary Dilution: 1:1000 (1% BSA); Secondary Dilution: 1:2000 (5% milk); Image Submitted By: Anonymous researcher See Customer Feedback tab for detailed information.

• 

  WB Suggested Anti-TSG101 Antibody Titration: 1.25ug/ml; Positive Control: NIH/3T3 cell lysate

• 

  WB Suggested Anti-TSG101 Antibody ; Positive Control: Lane 1: 30ug mouse brain lysate Lane 2: 30ug mouse brain lysate Lane 3: 30ug mouse brain lysate; Primary Antibody Dilution : 1:1000; Secondary Antibody : Goat anti-rabbit-HRP; Secondry Antibody Dilutio

• 

  Rabbit Anti-Tsg101 Antibody; Paraffin Embedded Tissue: Mouse Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSG101 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: tumor susceptibility gene 101
• Database Link:
  NP_068684
  Entrez Gene 22088 Mouse
  UniProt ID Q61187
• Background: TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
• Synonyms: TSG10; VPS23
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Goat: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Horse: 79%; Human: 79%; Rabbit: 79%