Rabbit polyclonal anti-RGS3 antibody
Applications | WB |
Reactivities | Human |
Immunogen | E. coli-expressed human RGS3 |
Rabbit polyclonal anti-RGS3 antibody
Applications | WB |
Reactivities | Human |
Immunogen | E. coli-expressed human RGS3 |
Rabbit Polyclonal Anti-RGS3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL |
Rabbit Polyclonal Anti-RGS3 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL |