Rabbit Polyclonal BAFF Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAFF antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BAFF. |
Rabbit Polyclonal BAFF Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAFF antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BAFF. |
Rabbit anti-TNFSF13B Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFSF13B |
Rabbit Polyclonal Anti-TNFSF13B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP |
Anti-Human BAFF Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BAFF |
Biotinylated Anti-Human BAFF Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BAFF |
Rabbit Polyclonal BAFF/BLyS/TNFSF13B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This rabbit polyclonal antibody was developed against a C-terminal peptide corresponding to amino acids 254-269 of human TNFSF13B. |
Rabbit anti BAFF/BLys/Thank/Tall-1 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |