Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-XPNPEP3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XPNPEP3 antibody: synthetic peptide directed towards the N terminal of human XPNPEP3. Synthetic peptide located within the following region: PVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQ

Rabbit polyclonal antibody to XPNPEP3 (X-prolyl aminopeptidase (aminopeptidase P) 3, putative)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 12 and 507 of XPNPEP3 (Uniprot ID#Q9NQH7)

Anti-XPNPEP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-49 amino acids of human X-prolyl aminopeptidase (aminopeptidase P) 3, putative